Recombinant Human CDC42 Protein
Produktgrößen
100 ug
£526,00
RP03136-100UG
Über dieses Produkt
- SKU:
- RP03136
- Zusätzliche Namen:
- CDC42, CDC42Hs Protein, G25K Protein
- Weitere Details:
- Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession #P60953-2) fused with a GST tag at the N-terminus.
- Formulierung:
- Recombinant Human CDC42 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Cys188) of human CDC42 (Accession #P60953-2) fused with a GST tag at the N-
- Immunogen:
- Met1-Cys188
- Molekulargewicht:
- 48.1 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP03136