Recombinant Human EG-VEGF/PK1 Protein
Produktgrößen
50 ug
£336,00
RP03103-50UG
Über dieses Produkt
- SKU:
- RP03103
- Zusätzliche Namen:
- EG-VEGF, PK1, PRK1
- Weitere Details:
- EG-VEGF, also known as prokineticin-1, is a member of the AVIT (prokineticin) family. Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. EG-VEGF can be detected in the steroidogenic glands, ovary, testis, adrenal and placenta. EG-VEGF has little or no effect on a variety of other endothelial and non-endothelial cell types. It induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. EG-VEGF may play a role in placentation. It may also function in normal and pathological testis angiogenesis. It positively regulates PTGS2 expression and prostaglandin synthesis.
- Formulierung:
- Recombinant Human Prokineticin-1/EG-VEGF Protein is produced by Baculovirus-Insect Cells expression system. The target protein is expressed with sequence (Met1-Phe105) of human Prokineticin-1/EG-VEGF
- Immunogen:
- Met1-Phe105
- Molekulargewicht:
- 15kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP03103