Recombinant Human Microfibrillar-associated protein 5 Protein
Produktgrößen
100 ug
£621,00
RP02966-100UG
Über dieses Produkt
- SKU:
- RP02966
- Zusätzliche Namen:
- AAT9|MAGP-2|MAGP2|MFAP-5|MP25
- Weitere Details:
- MFAP5 (Microfibril Associated Protein 5, also known as MAGP2) is a Protein Coding gene. MFAP5 is a component of the elastin-associated microfibrils. It belongs to the MFAP family. As a 25-kD microfibril-associated glycoprotein, MFAP5 is rich in serine and threonine residues. It stimulates the assembly of elastic fibers, a complex structure composed of a tropoelastin inner core and microfibril outer mantle comprising proteins such as fibrillins and microfibril-associated glycoproteins that guide tropoelastin deposition. MFAP5 also stabilizes type 1 procollagen and thus plays an important role in extracellular matrix homeostasis. It has multiple binding regions on fibrillins and has a covalent periodic association with fibrillin-containing microfibrils. Diseases associated with MFAP5 include Aortic Aneurysm, Familial Thoracic 9, and Familial Thoracic Aortic Aneurysm And Aortic Dissection.
- Formulierung:
- Recombinant Human Microfibrillar-associated protein 5 Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Met1-Leu173) of human Microfibrillar-associa
- Immunogen:
- Met1-Leu173
- Molekulargewicht:
- 29, 54 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥85%
- Sequenz:
- MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02966