Recombinant Mouse IL-22 Protein
Produktgrößen
10 ug
£163,00
RP02942-10UG
20 ug
£223,00
RP02942-20UG
50 ug
£336,00
RP02942-50UG
100 ug
£508,00
RP02942-100UG
500 ug
£1478,00
RP02942-500UG
1000 ug
£2335,00
RP02942-1000UG
Über dieses Produkt
- SKU:
- RP02942
- Zusätzliche Namen:
- IL-22,If2b1,Iltif,IL-22a, ILTIFa,IL22
- Weitere Details:
- Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10RB Beta (previously known as CRF2-4), belonging to the class II cytokine receptor family.
- Formulierung:
- Recombinant Mouse IL-22 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu34-Val179) of mouse IL-22 (Accession #NP_058667.1) fused with 6xHis at
- Immunogen:
- Leu34-Val179
- Molekulargewicht:
- 15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02942