Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein
Produktgrößen
10 ug
£193,00
RP02873-10UG
50 ug
£478,00
RP02873-50UG
500 ug
£2192,00
RP02873-500UG
Über dieses Produkt
- SKU:
- RP02873
- Zusätzliche Namen:
- CGB3,CGB,CGB5,CGB7,CGB8,hCGB
- Weitere Details:
- Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
- Formulierung:
- Recombinant Human Choriogonadotropin subunit beta 3/CGB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Gln165) of Human Choriogonadotropin
- Immunogen:
- Ser21-Gln165
- Molekulargewicht:
- 28-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02873