Recombinant Mouse DLK1 Protein
Produktgrößen
100 ug
£353,00
RP02871-100UG
500 ug
£1336,00
RP02871-500UG
1000 ug
£1954,00
RP02871-1000UG
Über dieses Produkt
- SKU:
- RP02871
- Zusätzliche Namen:
- DLK|DLK-1|DLK1|FA1|pG2|Pref1|secredeltin|ZOG
- Weitere Details:
- paternally inherited genetic defects of DLK1 were identified in four families with nonsyndromic CPP and a metabolic phenotype. DLK1 encodes a transmembrane protein that is important for adipose tissue homeostasis and neurogenesis and is located in the imprinted chromosome 14q32 region associated with Temple syndrome.
- Formulierung:
- Recombinant Mouse DLK1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Gln305) of Mouse DLK1 (Accession #NP_034182.2) fused with 6xHis tag a
- Immunogen:
- Ala24-Gln305
- Molekulargewicht:
- 50-68 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE.≥ 95 %
- Sequenz:
- AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELPVQQPEQHILKVSMKELNKSTPLLTEGQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02871
