Recombinant Human Granzyme B/CTLA-1/GZMB Protein
Produktgrößen
10 ug
£193,00
RP02860-10UG
20 ug
£258,00
RP02860-20UG
500 ug
£1716,00
RP02860-500UG
1000 ug
£2716,00
RP02860-1000UG
Über dieses Produkt
- SKU:
- RP02860
- Zusätzliche Namen:
- C11|CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|GZMB|HLP|SECT
- Weitere Details:
- Granzyme B, also known as GZMB, is the most prominent member of the granzyme family of cell death-inducing serine proteases expressed in the granules of cytotoxic T lymphocytes (CTLs) and NK cells. Granzyme B enters the target cells depending on another membrane-binding granule protein, perforin, results in the activation of effector caspases and mitochondrial depolarization through caspase-dependent and -independent pathways, and consequently induces rapid cell apoptosis. Over 3 substrates of GZMB have been identified including the key substrate caspase-3, ICAD, and Bid. GZMB is suggested to protect the host by lysing cells bearing on their surface 'nonself' antigens such as bacterial and viral infected-cells and tumor cells and accordingly plays an essential role in immunosurveillance.
- Formulierung:
- Recombinant Human Granzyme B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly19-Tyr247) of human Granzyme B (Accession #NP_004122.1) fused with
- Immunogen:
- Gly19-Tyr247
- Molekulargewicht:
- 35-40 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP02860