Recombinant Mouse Sclerostin/SOST Protein
Produktgrößen
10 ug
£193,00
RP02845-10UG
50 ug
£383,00
RP02845-50UG
100 ug
£586,00
RP02845-100UG
500 ug
£1716,00
RP02845-500UG
1000 ug
£2716,00
RP02845-1000UG
Über dieses Produkt
- SKU:
- RP02845
- Zusätzliche Namen:
- SOST,CDD,DAND6,SOST1,VBCH
- Weitere Details:
- Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.
- Formulierung:
- Recombinant Mouse Sclerostin/SOST Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Tyr211) of mouse Sclerostin/SOST (Accession #NP_077769.4)
- Immunogen:
- Gln24-Tyr211
- Molekulargewicht:
- 30-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02845