Recombinant Human GPX4 Protein
Produktgrößen
100 ug
£621,00
RP02834-100UG
Über dieses Produkt
- SKU:
- RP02834
- Zusätzliche Namen:
- GPx-4|GPX4|GSHPx-4|MCSP|PHGPx|SMDS|snGPx|snPHGPx
- Weitere Details:
- Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession #NP_002076.2) fused with a 6xHis tag at the N-terminus.
- Formulierung:
- Recombinant Human GPX4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly26-Phe197,U73C) of human GPX4 (Accession #NP_002076.2) fused with a 6xHis tag
- Immunogen:
- Gly26-Phe197,U73C
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP02834