Recombinant Mouse TNFSF12/TWEAK Protein
Produktgrößen
50 ug
£336,00
RP02821-50UG
Über dieses Produkt
- SKU:
- RP02821
- Zusätzliche Namen:
- TNFSF12,APO3L,DR3LG,TNLG4A,TWEAK
- Weitere Details:
- TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation.
- Formulierung:
- Recombinant Mouse TNFSF12/TWEAK Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Arg105-His249) of mouse TNFSF12/TWEAK (Accession #NP_035744.1) fus
- Immunogen:
- Arg105-His249
- Molekulargewicht:
- 20,35,45-50 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- RAIAAHYEVHPRPGQDGAQAGVDGTVSGWEETKINSSSPLRYDRQIGEFTVIRAGLYYLYCQVHFDEGKAVYLKLDLLVNGVLALRCLEEFSATAASSPGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02821
