Recombinant Mouse Asprosin/Fibrillin-1/FBN1 Protein
Produktgrößen
10 ug
£193,00
RP02819-10UG
20 ug
£258,00
RP02819-20UG
50 ug
£383,00
RP02819-50UG
500 ug
£1716,00
RP02819-500UG
1000 ug
£2716,00
RP02819-1000UG
Über dieses Produkt
- SKU:
- RP02819
- Zusätzliche Namen:
- Asprosin|Fbn-1|Fbn1|Fibrillin-1
- Weitere Details:
- Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
- Formulierung:
- Recombinant Mouse Fibrillin-1/FBN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2734-His2873) of mouse Fibrillin-1/FBN1 (Accession #AAA56840
- Immunogen:
- Ser2734-His2873
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Datenblatt des Herstellers:RP02819