Recombinant Human Lymphotactin/XCL1 Protein
Produktgrößen
10 ug
£133,00
RP02815-10UG
20 ug
£181,00
RP02815-20UG
50 ug
£240,00
RP02815-50UG
500 ug
£1002,00
RP02815-500UG
1000 ug
£1574,00
RP02815-1000UG
Über dieses Produkt
- SKU:
- RP02815
- Zusätzliche Namen:
- XCL1, LTN, SCYC1,Lymphotactin, ATAC, C motif chemokine 1, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1, XC chemokine ligand 1
- Weitere Details:
- This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1.
- Formulierung:
- Recombinant Human Lymphotactin/XCL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val22-Gly114) of Human Lymphotactin/XCL1 (Accession #NP_002986
- Immunogen:
- Val22-Gly114
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02815