Recombinant Human AMBP Protein
Produktgrößen
10 ug
£145,00
RP02794-10UG
50 ug
£288,00
RP02794-50UG
500 ug
£1907,00
RP02794-500UG
1000 ug
£1954,00
RP02794-1000UG
Über dieses Produkt
- SKU:
- RP02794
- Zusätzliche Namen:
- A1M|AMBP|EDC1|HCP|HI30|IATIL|ITI|ITIL|ITILC|UTI
- Weitere Details:
- Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: A Alpha-1-microglobulin, inter-A Alpha-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. A Alpha-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-A Alpha-trypsin inhibitor is present in the plasma and urine. A Alpha-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-A Alpha-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.
- Formulierung:
- Recombinant Human AMBP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly20-Val203) of human AMBP (Accession #NP_001624.1) fused with a 6xHis tag
- Immunogen:
- Gly20-Val203
- Molekulargewicht:
- 33 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02794