Recombinant Human CXCL14/BRAK Protein
Produktgrößen
10 ug
£145,00
RP02782-10UG
20 ug
£193,00
RP02782-20UG
500 ug
£1240,00
RP02782-500UG
1000 ug
£1954,00
RP02782-1000UG
Über dieses Produkt
- SKU:
- RP02782
- Zusätzliche Namen:
- BMAC|BRAK|CXCL14|KEC|KS1|MIP-2g|MIP2G|NJAC|SCYB14
- Weitere Details:
- CXCL14 is a CXC chemokine family that exhibits antimicrobial activity and contains an amphipathic cationic alpha-helical region in the C-terminus, a characteristic structure of antimicrobial peptides (AMPs). CXCL14 is involved in cell recruitment, migration, activation, and homing in liver diseases and have been shown to be upregulated during acute liver injury in animal models. The CXC chemokine ligand 14 (CXCL14) had been show highly expressed in tumor-associated stromal cells, promoting tumor cell growth, and invasion.
- Formulierung:
- Recombinant Human CXCL14/BRAK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Glu111) of human CXCL14/BRAK (Accession #NP_004878.2) fused wit
- Immunogen:
- Met1-Glu111
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02782