Recombinant Human IL-15RA&IL-15 Protein
Produktgrößen
100 ug
£431,00
RP02654-100UG
500 ug
£1478,00
RP02654-500UG
1000 ug
£2430,00
RP02654-1000UG
Über dieses Produkt
- SKU:
- RP02654
- Zusätzliche Namen:
- IL-15 R alpha; CD215; IL15RA; IL-15RA; IL-15R-alpha1; Interleukin-15; IL-15; IL15
- Weitere Details:
- Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.
- Formulierung:
- Recombinant Human IL-15RA&IL-15 Protein is expressed from Expi293 with His tag at the C-terminal.; It contains Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15).
- Immunogen:
- Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15)
- Molekulargewicht:
- 26-28, 30-32 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02654