Recombinant Cynomolgus DNAM-1/CD226 Protein
Produktgrößen
100 ug
£431,00
RP02629-100UG
500 ug
£1544,00
RP02629-500UG
1000 ug
£2430,00
RP02629-1000UG
Über dieses Produkt
- SKU:
- RP02629
- Zusätzliche Namen:
- CD226|CD226 molecule|DNAM1|PTA1|TLiSA1
- Weitere Details:
- DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.
- Formulierung:
- Recombinant Cynomolgus DNAM-1/CD226 Protein is expressed from Expi293 with His tag at the C-terminal.; It contains Glu19-Phe252.
- Immunogen:
- Glu19-Phe252
- Molekulargewicht:
- 48-68 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKVQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRF
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02629
