Recombinant Human GFR alpha-like/GFRAL Protein
Produktgrößen
100 ug
£431,00
RP02625-100UG
500 ug
£1544,00
RP02625-500UG
1000 ug
£2430,00
RP02625-1000UG
Über dieses Produkt
- SKU:
- RP02625
- Zusätzliche Namen:
- C6orf144|GFR alpha-like|GFRAL|GRAL
- Weitere Details:
- GFR alpha -like (GDNF receptor-alpha-like) is a distant member of the GDNFR family of proteins. Mature human GFR alpha-like is a 376 amino acid (aa) type I transmembrane protein. It contains a 333 aa extracellular domain, a 20 aa transmembrane domain and a 23 aa cytoplasmic domain.GFRAL is a brainstem-restricted receptor for GDF15 which regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses.
- Formulierung:
- Recombinant Human GFR alpha-like/GFRAL Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser19-Glu351) of Human GFR alpha-like/GFRAL (Accession #) f
- Immunogen:
- Ser19-Glu351
- Molekulargewicht:
- 70-80 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02625