Recombinant Human IL-17Rc Protein
Produktgrößen
100 ug
£431,00
RP02624-100UG
500 ug
£1544,00
RP02624-500UG
1000 ug
£2430,00
RP02624-1000UG
Über dieses Produkt
- SKU:
- RP02624
- Zusätzliche Namen:
- IL-17 receptor C|IL-17RC|IL-17RL|IL17Rhom|ZcytoR14
- Weitere Details:
- IL-17RC (interleukin-17 receptor-like) gene codes for a transmembrane protein, the full length of which inhibits apoptosis in prostate cancer cells. IL-17RC gene transcribes over a dozen different splice variants of mRNA. IL-17RC protein isoforms are differentially expressed in prostatic cells and cancer tissues and may play a negative or positive role in the initiation and progression of prostate cancer.
- Formulierung:
- Recombinant Human IL-17Rc Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Leu21-Arg467.
- Immunogen:
- Leu21-Arg467
- Molekulargewicht:
- 90-115 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- LERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02624
