Recombinant Human TSLPR Protein
Produktgrößen
100 ug
£395,00
RP02623-100UG
500 ug
£1478,00
RP02623-500UG
1000 ug
£2258,00
RP02623-1000UG
Über dieses Produkt
- SKU:
- RP02623
- Zusätzliche Namen:
- CRL2|CRLF2|CRLF2Y|IL-XR|p2RY8/CRLF2 fusion|TSLP receptor|TSLPR
- Weitere Details:
- Thymic stromal lymphopoietin (TSLP) is an interleukin-7 (IL-7) like cytokine, which plays an important role in the regulation of immune responses to allergens. TSLP binds to a heterodimeric receptor complex composed of the IL-7 receptor alpha chain (IL-7Ralpha) and the TSLP receptor (TSLPR, also known as CRLF2).
- Formulierung:
- Recombinant Human TSLPR Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Gly25-Lys231.
- Immunogen:
- Gly25-Lys231
- Molekulargewicht:
- 60-75 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02623