Recombinant Human OSCAR Protein
Produktgrößen
100 ug
£395,00
RP02616-100UG
500 ug
£1478,00
RP02616-500UG
1000 ug
£2258,00
RP02616-1000UG
Über dieses Produkt
- SKU:
- RP02616
- Zusätzliche Namen:
- MGC33613|mOSCAR|OSCAR|PIgR-3|PIGR3|Poly-Ig receptor 3
- Weitere Details:
- Osteoclast-associated receptor (OSCAR) is a co-stimulatory receptor in osteoclastogenesis. Synovial tissues from active rheumatoid arthritis (RA) patients express higher levels of OSCAR compared with osteoarthritic and normal patients. OSCAR and tartrate-resistant acid phosphatase (TRAP) expression levels did not differ between the cartilage pannus junction (CPJ) and non-CPJ regions in active RA.
- Formulierung:
- Recombinant Human OSCAR Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Asp19-Asn229.
- Immunogen:
- Asp19-Ser229
- Molekulargewicht:
- 60-70 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02616
