Recombinant Mouse BAMBI Protein
Produktgrößen
100 ug
£336,00
RP02614-100UG
500 ug
£1193,00
RP02614-500UG
1000 ug
£1764,00
RP02614-1000UG
Über dieses Produkt
- SKU:
- RP02614
- Zusätzliche Namen:
- Bambi|Nma
- Weitere Details:
- Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane protein that affects the growth, development and muscle regeneration of the body by regulating the TGF-B Beta, BMP and Wnt signaling pathways. In brief, BAMBI may be a functional gene for the differentiation of bovine preadipocytes and myoblasts, and variations in the BAMBI genomic region, especially the combined haplotype H1H4, may benefit marker-assisted selection in cattle.
- Formulierung:
- Recombinant Mouse BAMBI Protein is expressed from Expi293 with hFc tag at the C-terminal.; It contains Glu27-Ala152.
- Immunogen:
- Glu27-Ala152
- Molekulargewicht:
- 49-55 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02614
