Recombinant Cynomolgus CRTAM/CD355 Protein
Produktgrößen
100 ug
£336,00
RP02611-100UG
500 ug
£1193,00
RP02611-500UG
1000 ug
£1764,00
RP02611-1000UG
Über dieses Produkt
- SKU:
- RP02611
- Zusätzliche Namen:
- CD355|CD355 antigen|CRTAM
- Weitere Details:
- Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNG Gamma by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile; therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
- Formulierung:
- Recombinant Cynomolgus CRTAM/CD355 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser18-Gly287) of Cynomolgus CRTAM/CD355 (Accession #) fused wit
- Immunogen:
- Ser18-Gly287
- Molekulargewicht:
- 70-80 kDa
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02611
