Recombinant Mouse IL-18 Protein
Produktgrößen
50 ug
£ POA
RP02521-50UG
20 ug
£193,00
RP02521-20UG
500 ug
£1478,00
RP02521-500UG
1000 ug
£2335,00
RP02521-1000UG
Über dieses Produkt
- SKU:
- RP02521
- Zusätzliche Namen:
- Ig, Il-, Igif, Il-18,IL18
- Weitere Details:
- Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-G Gamma (IFN-G Gamma) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity.
- Formulierung:
- Recombinant Mouse IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn36-Ser192) of Mouse IL-18 fused with His tag at the C-terminus
- Immunogen:
- Asn36-Ser192
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02521
