Recombinant Mouse IL-1 alpha Protein
Produktgrößen
10 ug
£145,00
RP02518-10UG
20 ug
£193,00
RP02518-20UG
50 ul
£288,00
RP02518-50UL
100 ul
£431,00
RP02518-100UL
500 ug
£1240,00
RP02518-500UG
1000 ug
£1954,00
RP02518-1000UG
Über dieses Produkt
- SKU:
- RP02518
- Zusätzliche Namen:
- Il1a , Interleukin-1 alpha, IL-1 alpha
- Weitere Details:
- Interleukin 1 alpha (IL-1A Alpha) also known as hematopoietin 1 is a cytokine of the interleukin 1 family that in humans is encoded by the IL1A gene. IL-1A Alpha is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. It binds to the interleukin-1 receptor. It is on the pathway that activates tumor necrosis factor-alpha.
- Formulierung:
- Recombinant Mouse IL-1 alpha Protein is produced by E. coli cells expression system. The target protein is expressed with sequence (Ser115-Ser270) of Mouse IL-1 alpha(Accession # P01582) fused with No
- Immunogen:
- Ser115-Ser270
- Molekulargewicht:
- 15-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequenz:
- SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02518