Recombinant Cynomolgus B7-H1/PD-L1/CD274 Protein
Produktgrößen
100 ug
£ POA
RP02471-100UG
500 ug
£1336,00
RP02471-500UG
1000 ug
£1574,00
RP02471-1000UG
Über dieses Produkt
- SKU:
- RP02471
- Zusätzliche Namen:
- CD274 antigenMGC142294, CD274 molecule, CD274,PDL1, PD-L1, PD-L1B7 homolog 1,B7-H, B7H1, B7-H1, B7H1PDCD1L1,? PDCD1L1, PDCD1LG1, PDCD1LG1MGC142296,? PDL1PDCD1 ligand 1, programmed cell death 1 ligand 1, Programmed death ligand 1, PDL1
- Weitere Details:
- Recombinant Cynomolgus PD-L1 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Phe19-Arg238) of Cynomolgus PD-L1 fused with a hFc tag at the C-terminal.
- Formulierung:
- Recombinant Cynomolgus PD-L1 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Phe19-Arg238) of Cynomolgus PD-L1 fused with a hFc tag at the C-terminal.
- Immunogen:
- Phe19-Arg238
- Molekulargewicht:
- 60-70 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNER
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02471
