Recombinant Mouse TNFRSF17/BCMA/CD269 Protein
Produktgrößen
100 ug
£353,00
RP02288-100UG
500 ug
£1336,00
RP02288-500UG
1000 ug
£1954,00
RP02288-1000UG
Über dieses Produkt
- SKU:
- RP02288
- Zusätzliche Namen:
- CD269 antigen, CD269, TNFRSF17, B cell maturation antigen, B-cell maturation protein, BCMA, BCMA tumor necrosis factor receptor superfamily member 17, BCMB-cell maturation factor, tumor necrosis factor receptor superfamily, member 17
- Weitere Details:
- Recombinant Mouse BCMA Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Met1-Thr49) of Mouse BCMA fused with hFc tag at the C-terminal.
- Formulierung:
- Recombinant Mouse BCMA Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Met1-Thr49) of Mouse BCMA fused with hFc tag at the C-terminal.
- Immunogen:
- Met1-Thr49
- Molekulargewicht:
- 38-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE;≥ 95 %
- Sequenz:
- MAQQCFHSEYFDSLLHACKPCHLRCSNPPATCQPYCDPSVTSSVKGTYT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02288
