Recombinant Mouse CD3E&CD3D Protein
Produktgrößen
100 ug
£508,00
RP02215-100UG
500 ug
£1830,00
RP02215-500UG
1000 ug
£2906,00
RP02215-1000UG
Über dieses Produkt
- SKU:
- RP02215
- Zusätzliche Namen:
- CD3|CD3 delta&CD3 epsilon|CD3d|CD3e|CD3E&CD3D|T3D
- Weitere Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 delta chain, also known as CD3E & CD3D , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Formulierung:
- Recombinant Mouse CD3E&CD3D Heterodimer Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp23-Asp108(P22646)&Phe22-Ala105(P04235)) of mouse CD3E&CD3D
- Immunogen:
- Asp23-Asp108(P22646)&Phe22-Ala105(P04235)
- Molekulargewicht:
- 50-65 kDa (CD3E), 40-50 kDa(CD3D)
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by Tris-Bis PAGE.≥ 95 %
- Sequenz:
- DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02215
