Recombinant Mouse TNFRSF18/GITR/CD357 Protein
Produktgrößen
10 ug
£145,00
RP02184-10UG
50 ug
£288,00
RP02184-50UG
500 ug
£1478,00
RP02184-500UG
1000 ug
£1954,00
RP02184-1000UG
Über dieses Produkt
- SKU:
- RP02184
- Zusätzliche Namen:
- AITR, Gitr, Tnfrsf18
- Weitere Details:
- Tumor necrosis factor receptor superfamily member 18(Gitr) contains 3 TNFR-Cys repeats and it have four isforms.IsformA , isformB and isformC is single-pass type I membrane protein and isformD is a secreted protein. The protein is the receptor for TNFSF18.It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. It mediated NF-kappa-B activation via the TRAF2/NIK pathway.It binds to TRAF1, TRAF2, and TRAF3, but not TRAF5 and TRAF6 and binds through its C-terminus to SIVA1/SIVA.It preferentially expressed in activated T lymphocytes and up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.
- Formulierung:
- Recombinant Mouse TNFRSF18/GITR/CD357 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Ser22-His153) of mouse GITR (Accession #O35714) fused with an F
- Immunogen:
- Ser22-His153
- Molekulargewicht:
- 60 kda
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02184