Recombinant Human FAM3B/PANDER Protein
Produktgrößen
50 ug
£ POA
RP02181-50UG
10 ug
£145,00
RP02181-10UG
500 ug
£1478,00
RP02181-500UG
1000 ug
£2430,00
RP02181-1000UG
Über dieses Produkt
- SKU:
- RP02181
- Zusätzliche Namen:
- FAM3B,2-21,C21orf11,C21orf76,ORF9,PANDER,PRED44
- Weitere Details:
- FAM3B, also known as Pancreatic-derived factor (PANDER), is an islet-specific secreted cytokine specifically expressed at high levels in the islets of Langerhans of the endocrine pancreas. FAM3B can induce apoptosis of alpha and beta cells in a dose- and time-dependent manner. Previous studies showed that FAM3B regulates glucose and lipid metabolism through interaction with liver and endocrine pancreas. FAM3B silencing activates both extrinsic and intrinsic apoptotic pathways. In general, silencing FAM3B promoted p53 phosphorylation and induced p53 accumulation by decreasing Mdm2 expression, which resulted in apoptotic cell death.
- Formulierung:
- Recombinant Human FAM3B/PANDER Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Glu30-Ser235) of human FAM3B (Accession #P58499) fused with an Fc tag
- Immunogen:
- Glu30-Ser235
- Molekulargewicht:
- 50-65 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02181