Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein
Produktgrößen
10 ug
£133,00
RP02179-10UG
20 ug
£181,00
RP02179-20UG
50 ug
£240,00
RP02179-50UG
100 ug
£353,00
RP02179-100UG
500 ug
£1240,00
RP02179-500UG
1000 ug
£1954,00
RP02179-1000UG
Über dieses Produkt
- SKU:
- RP02179
- Zusätzliche Namen:
- ANGPTL4,ARP4,FIAF,HARP,HFARP,NL2,PGAR,TGQTL,UNQ171,pp1158
- Weitere Details:
- Angiopoietin-related protein 4 ( ANGPTL4 ) is a secreted protein and contains 1 fibrinogen C-terminal domain. The protein may act as a regulator of angiogenesis and modulate tumorigenesis. It inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. ANGPTL4 may exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity (By similarity). In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.
- Formulierung:
- Recombinant Human Angiopoietin-like 4/ANGPTL4(166-406) Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Pro166-Ser406) of human ANGPTL4 (Accession #Q9
- Immunogen:
- Pro166-Ser406
- Molekulargewicht:
- 32-38 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- PEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02179