Recombinant Human BTN3A3 Protein
Produktgrößen
10 ug
£145,00
RP02154-10UG
50 ug
£336,00
RP02154-50UG
500 ug
£2050,00
RP02154-500UG
1000 ug
£2430,00
RP02154-1000UG
Über dieses Produkt
- SKU:
- RP02154
- Zusätzliche Namen:
- BTN3A3,BTF3,BTN3.3
- Weitere Details:
- Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.
- Formulierung:
- Recombinant Human BTN3A3 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln30-Trp248) of human BTN3A3 (Accession #O00478) fused with a 6xHis tag at
- Immunogen:
- Gln30-Trp248
- Molekulargewicht:
- 30 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02154