Recombinant Human BTN3A2 Protein
Produktgrößen
10 ug
£193,00
RP02153-10UG
50 ug
£478,00
RP02153-50UG
500 ug
£2192,00
RP02153-500UG
Über dieses Produkt
- SKU:
- RP02153
- Zusätzliche Namen:
- BT3.2, BTF4, BTN3.2, CD277, BTN3A2
- Weitere Details:
- Butyrophilin subfamily 3 member A2, also known as BT3.2, BTF3, BTF4 and BTN3A2, is a single-pass type I membrane protein. It is a member of the butyrophilin (BTN) family and the immunoglobulin (IG) superfamily. Mature human BTN3A2 is a 305 amino acid (aa) glycoprotein. It contains a 219 aa extracellular region with one V-type Ig-like domain, and a 65 aa cytoplasmic tail. The cytoplasmic region undergoes phosphorylation on two serines. There are three potential splice forms. BTN3A2 is postulated to be expressed on immune-related cells, as it has a structural similarity to MHC and CD80/CD86 molecules. It plays a role in T-cell responses in the adaptive immune response and inhibits the release of IFNG from activated T-cells.
- Formulierung:
- Recombinant Human BTN3A2 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Gln30-Trp248) of human BTN3A2 (Accession #P78410) fused with a 6xHis tag at
- Immunogen:
- Gln30-Trp248
- Molekulargewicht:
- 29 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02153