Recombinant Human TMPO Protein
Produktgrößen
10 ug
£145,00
RP02141-10UG
50 ug
£336,00
RP02141-50UG
500 ug
£2050,00
RP02141-500UG
1000 ug
£2430,00
RP02141-1000UG
Über dieses Produkt
- SKU:
- RP02141
- Zusätzliche Namen:
- TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin,CMD1T,LAP2,LEMD4,PRO0868,TP
- Weitere Details:
- Thymopentin is a member of the LEM family. Thymopentin is expressed in many tissues, highly in the adult thymus and fetal liver. The N-terminal contains two structurally independent domains, LEM domain and LEM-like domain. The C-terminal domain forms a four-stranded coiled coil. Thymopentin may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It is associated with T-cell development and function. Meantime, Thymopentin plays an important role, together with LMNA, in the nuclear anchorage of RB1. Thymopoietin is participated in the induction of CD90 in the thymus.
- Formulierung:
- Recombinant Human TMPO Protein is produced by E.coli expression system. The target protein is expressed with sequence (Pro2-Glu187) of human TMPO (Accession #P42167) fused with a 6xHis tag at the C- t
- Immunogen:
- Pro2-Glu187
- Molekulargewicht:
- 27 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02141