Recombinant Cynomolgus CD3E&CD3G Protein
Produktgrößen
100 ug
£508,00
RP02060-100UG
500 ug
£1984,00
RP02060-500UG
1000 ug
£2906,00
RP02060-1000UG
Über dieses Produkt
- SKU:
- RP02060
- Zusätzliche Namen:
- CD3 epsilon&CD3 gamma|CD3E&CD3G
- Weitere Details:
- T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
- Formulierung:
- Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&C
- Immunogen:
- Gln22-Asp117(Q95LI52)&Gln23-Thr113(Q95LI7)
- Molekulargewicht:
- 44-46 kDa(CD3E), 46-48 kDa (CD3G)
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequenz:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDQSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02060
