Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein
Produktgrößen
100 ug
£431,00
RP02009-100UG
500 ug
£1544,00
RP02009-500UG
1000 ug
£2430,00
RP02009-1000UG
Über dieses Produkt
- SKU:
- RP02009
- Zusätzliche Namen:
- BCMA|TNFRSF17
- Weitere Details:
- B-cell maturation antigen (BCMA or BCM), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a protein that in humans is encoded by the TNFRSF17 gene.TNFRSF17 is a cell surface receptor of the TNF receptor superfamily which recognizes B-cell activating factor (BAFF).
- Formulierung:
- Recombinant Human Angiopoietin-2/ANGPT2 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Met1-Ala53) of cynomolgus BCMA (Accession #G7Q0I4) fused with
- Immunogen:
- Met1-Ala53
- Molekulargewicht:
- 35-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequenz:
- MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02009