Recombinant Human CD3 delta Protein
Produktgrößen
100 ug
£336,00
RP02006-100UG
500 ug
£1002,00
RP02006-500UG
1000 ug
£1764,00
RP02006-1000UG
Über dieses Produkt
- SKU:
- RP02006
- Zusätzliche Namen:
- CD3D,CD3-DELTA,IMD19,T3D, IMD19, T3D
- Weitere Details:
- T-cell surface glycoprotein CD3 delta chain, also known as CD3D, is a single-pass type I membrane protein.In immunology, the CD3 (cluster of differentiation 3) T cell co-receptor helps to activate both the cytotoxic T cell (CD8+ naive T cells) and also T helper cells (CD4+ naive T cells). It consists of a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3G Gamma chain, a CD3D Delta chain, and two CD3E Epsilon chains.
- Formulierung:
- Recombinant Human CD3 delta Protein is produced by mammalian expression system. The target protein is expressed with sequence (Phe22-Ala105) of Human CD3 delta (Accession #P04234) fused with a 6xHis t
- Immunogen:
- Phe22-Ala105
- Molekulargewicht:
- 15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequenz:
- FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP02006
