Recombinant Human FCRL2/FCRH2 /IRTA4 Protein
Produktgrößen
20 ug
£181,00
RP01984-20UG
50 ug
£240,00
RP01984-50UG
100 ug
£353,00
RP01984-100UG
500 ug
£1002,00
RP01984-500UG
1000 ug
£1574,00
RP01984-1000UG
Über dieses Produkt
- SKU:
- RP01984
- Zusätzliche Namen:
- FCRL2, FCRH2, IFGP4, IRTA4, SPAP1, UNQ9236/PRO31998, Fc receptor-like protein 2, FcR-like protein 2, FcRL2, Fc receptor homolog 2, FcRH2, IFGP family protein 4, Immunoglobulin receptor translocation-associated protein 4, SH2 domain-containing phosphatase anchor protein 1, CD307b
- Weitere Details:
- FCRL2/FCRH2 /IRTA4, belongs to the family of glycoprotein homologs of classical immunoglobulin (Ig) Fc receptors. In human, the type I transmembrane FCRL protein family contains from three to nine immunoglobulin-like domains . Mature human FcRH2 consists of a 382 amino acid (aa) extracellular domain (ECD) with four Ig-like C2-set domains, a 21 aa transmembrane segment, and an 86 aa cytoplasmic domain with one ITAM-like, and two ITIM-like motifs. Alternate splicing of human FCRL2 may generate isoforms with N-terminal, internal, or C-terminal deletions . The gene for FcRH2 maps to the human Iq21-23 locus which is a hotspot for chromosomal translocation events associated with B cell malignancies . Although there are several Fc receptor-like genes in the mouse, none of these is a clear ortholog to human FCRL2 . FCRL proteins are differentially expressed among B cells . FCRL2 is preferentially expressed on naive and CD27+ memory B cells within the spleen, lymph nodes, tonsils, and peripheral blood . It is also expressed on most B cells in B cell chronic lymphocytic leukemia (B-CLL) patients. FCRL2 upregulation is associated with mutation of the immunoglobulin heavy chain variable (IGHV) and less aggressive forms of B-CLL.
- Formulierung:
- Recombinant Human FCRL2/FCRH2 /IRTA4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp395) of Human FCRL2/FCRH2 /IRTA4 (Accession #NP_1103
- Immunogen:
- Leu20-Asp395
- Molekulargewicht:
- 60-75 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01984