Recombinant Human AMHR2/MISR2 Protein
Produktgrößen
20 ug
£181,00
RP01982-20UG
50 ug
£240,00
RP01982-50UG
100 ug
£353,00
RP01982-100UG
500 ug
£1002,00
RP01982-500UG
1000 ug
£1574,00
RP01982-1000UG
Über dieses Produkt
- SKU:
- RP01982
- Zusätzliche Namen:
- AMHR2, AMHR, MISR2,Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII
- Weitere Details:
- AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.
- Formulierung:
- Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala17-Ser144) of Human AMHR2/MISR2 (Accession #NP_065434.1) fused wi
- Immunogen:
- Ala17-Ser144
- Molekulargewicht:
- 15-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- APPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Datenblatt des Herstellers:RP01982