Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein
Produktgrößen
20 ug
£193,00
RP01978-20UG
50 ug
£288,00
RP01978-50UG
100 ug
£431,00
RP01978-100UG
500 ug
£1240,00
RP01978-500UG
1000 ug
£1954,00
RP01978-1000UG
Über dieses Produkt
- SKU:
- RP01978
- Zusätzliche Namen:
- Klrb1c, Ly55c, Nkrp1c,Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c, Ly-55c, NK1.1, NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40, NKR-P1 40, CD161c
- Weitere Details:
- Plays a stimulatory role on natural killer (NK) cells cytotoxicity. Activation by cross-linking of the receptor induces Ca2+ mobilization and interferon-gamma production.
- Formulierung:
- Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln67-Ser223) of Mouse Nkrp1c/NK1.1/CD161c (Accession #NP_00
- Immunogen:
- Gln67-Ser223
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01978