Recombinant Human CCL15/MIP-5/HCC-2 Protein
Produktgrößen
10 ug
£145,00
RP01966-10UG
20 ug
£193,00
RP01966-20UG
50 ug
£288,00
RP01966-50UG
100 ug
£431,00
RP01966-100UG
500 ug
£1240,00
RP01966-500UG
1000 ug
£1954,00
RP01966-1000UG
Über dieses Produkt
- SKU:
- RP01966
- Zusätzliche Namen:
- CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
- Weitere Details:
- Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.
- Formulierung:
- Recombinant Human CCL15/MIP-5/HCC-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser46-Ile113) of Human CCL15/MIP-5/HCC-2 (Accession #NP_116741
- Immunogen:
- Ser46-Ile113
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01966