Recombinant Human Thy-1/CD90 Protein
Produktgrößen
20 ug
£181,00
RP01965-20UG
50 ug
£240,00
RP01965-50UG
100 ug
£353,00
RP01965-100UG
500 ug
£1002,00
RP01965-500UG
1000 ug
£1574,00
RP01965-1000UG
Über dieses Produkt
- SKU:
- RP01965
- Zusätzliche Namen:
- THY1,Thy-1 membrane glycoprotein, CDw90, Thy-1 antigen, CD90
- Weitere Details:
- CD90, also known as Thy1, is an approximately 25-35 kDa glycoprotein that mediates cellular adhesion and exerts wide ranging effects in different tissues. CD90 is expressed on hematopoietic progenitor cells, neurons, and activated vascular endothelial cells. Its species-specific expression in lymphoid cells allows its use as a thymocyte and pan T cell marker in mouse but not in human. CD90 can form dimers and higher order multimers. It binds to heparin, the proteoglycan Syndecan-4, and Integrins alpha M beta 2, alpha V beta 3, and alpha V beta 5. Through these interactions, CD90 inhibits neurite outgrowth, promotes astrocyte adhesion, mediates the adhesion and extravasation of leukocytes and melanoma cells, supports the Thrombospondin-1 induced disassembly of fibroblast focal adhesions, and inhibits the activation of latent TGF-beta 1, myofibroblast differentiation, and lung fibrosis. Human Thy-1 shares 63% and 66% amino acids similarity with mouse and rat homolog.
- Formulierung:
- Recombinant Human Thy-1/CD90 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln20-Cys130) of Human Thy-1/CD90 (Accession #NP_001298089.1) fused w
- Immunogen:
- Gln20-Cys130
- Molekulargewicht:
- 25-35KDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01965