Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein
Produktgrößen
20 ug
£193,00
RP01961-20UG
50 ug
£288,00
RP01961-50UG
100 ug
£431,00
RP01961-100UG
500 ug
£1240,00
RP01961-500UG
1000 ug
£1954,00
RP01961-1000UG
Über dieses Produkt
- SKU:
- RP01961
- Zusätzliche Namen:
- ITPRIPL1, KIAA1754L,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
- Weitere Details:
- ITPRIPL1/KIAA1754L/CD3L1 is a transmembrane protein with broad expression in the testis associated with immune evasion. In fact, ITPRIPL1 is a molecule specifically expressed in immune privileged tissues, "hot" tumors without PD-L1 expression, and non-responding tumors to PD-1 blockade therapy. ITPRIPL1 has been shown to impair T cell function in vitro and in vivo through CD3e with experimental evidence supporting a negative correlation between ITPRIPL1 expression level in antigen-presenting cells and T cell cytotoxicity. ITPRIPL1 was a hypermethylated-low expression gene in breast cancer and acted as an independent biomarker for the prognosis of lung adenocarcinoma by using bioinformatics methods. Thus, targeting the ITPRIPL1-CD3e axis, especially in PD-1 - PD-L1 negative patients, is a promising therapeutic strategy to reduce immune evasion.
- Formulierung:
- Recombinant HumanITPRIPL1/KIAA1754L/CD3L1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His25-103Gly) of Human ITPRIPL1/KIAA1754L/CD3L1 Protein
- Immunogen:
- His25-103Gly
- Molekulargewicht:
- 40-45 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01961