Recombinant Human Mature MIS/AMH Protein
Produktgrößen
10 ug
£264,00
RP01956-10UG
20 ug
£407,00
RP01956-20UG
50 ug
£621,00
RP01956-50UG
100 ug
£966,00
RP01956-100UG
500 ug
£2906,00
RP01956-500UG
1000 ug
£4620,00
RP01956-1000UG
Über dieses Produkt
- SKU:
- RP01956
- Zusätzliche Namen:
- Muellerian-inhibiting factor, Anti-Muellerian hormone, AMH, Muellerian-inhibiting substance, MIS,AMH, MIF
- Weitere Details:
- Anti-Mullerian hormone (AMH), a member of the TGF-beta superfamily, is produced by granulosa cells (GCs) of preantral and small antral follicles and plays a role in regulating the recruitment of primordial follicles and the FSH-dependent development of follicles. BMP15 up-regulates the transcription of AMH and that the inhibition of p38 MAPK decreases the BMP15-induced expression of AMH and SOX9, suggesting that BMP15 up-regulates the expression of AMH via the p38 MAPK signaling pathway, and this process involves the SOX9 transcription factor. AMH is widely used for assessing ovarian reserve, and it is particularly convenient, because it is thought to have minimal variability throughout the menstrual cycle. Fetal anti-Mullerian hormone (AMH) is responsible for normal male sexual differentiation, and circulating AMH is used as a marker of testicular tissue in newborns with disorders of sex development. Anti-Mullerian hormone (AMH) produced in the developing testis induces the regression of the Mullerian duct, which develops into the oviducts, uterus and upper vagina. As well as other hormone receptors, and a decreased ovarian cortex cell proliferation. These results help understand the inhibitory effects of AMH on follicular development.
- Formulierung:
- Recombinant Human Mature MIS/AMH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser452-Arg560)of Human Mature MIS/AMH (Accession #NP_000470.2) fu
- Immunogen:
- Ser452-Arg560
- Molekulargewicht:
- 15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- SAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01956