Recombinant Human IL-19 Protein
Produktgrößen
10 ug
£145,00
RP01949-10UG
20 ug
£193,00
RP01949-20UG
50 ug
£288,00
RP01949-50UG
100 ug
£431,00
RP01949-100UG
500 ug
£1240,00
RP01949-500UG
1000 ug
£1954,00
RP01949-1000UG
Über dieses Produkt
- SKU:
- RP01949
- Zusätzliche Namen:
- IL19, ZMDA1,Interleukin-19, IL-19, Melanoma differentiation-associated protein-like protein, NG.1
- Weitere Details:
- The molecular features at the IL19 locus may modestly alter the establishment of HIV-1 infection. Interleukin (IL) 19, IL-20, and IL-24 belong to the IL-10 cytokine family and have been identified to play a role in the regulation of epidermal functions and inflammation. The expression of IL19 in biopsies of patients with active ulcerative colitis was increased compared with patients with quiescent ulcerative colitis and that colitis was attenuated in IL-19-deficient mice. The disruption of the epithelial barrier with dextran sodium sulfate leads to increased IL-19 expression. Attenuated colitis in IL-19-deficient animals was associated with reduced numbers of IL-6-producing macrophages in the inflamed colonic lamina propria. Microbial-driven expression of IL-19 by intestinal macrophages may contribute to the pathogenesis of inflammatory bowel disease.
- Formulierung:
- Recombinant Human IL-19 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Ala177)of Human IL-19 (Accession #NP_715639.2) fused with a His tag
- Immunogen:
- Leu25-Ala177
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01949