Recombinant Human CCL8/MCP-2 Protein
Produktgrößen
10 ug
£145,00
RP01947-10UG
20 ug
£193,00
RP01947-20UG
50 ug
£288,00
RP01947-50UG
100 ug
£431,00
RP01947-100UG
500 ug
£1240,00
RP01947-500UG
1000 ug
£1954,00
RP01947-1000UG
Über dieses Produkt
- SKU:
- RP01947
- Zusätzliche Namen:
- CCL8, MCP2, SCYA10, SCYA8,C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8, Cleaved into: MCP-2(6-76)
- Weitere Details:
- MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes.
- Formulierung:
- Recombinant Human CCL8/MCP-2 Protein by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro99) of Human CCL8/MCP-2 (Accession #NP_005614.2) fused with No tag.
- Immunogen:
- Gln24-Pro99
- Molekulargewicht:
- 10-15 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01947