Recombinant Mouse Cripto/TDGF1 Protein
Produktgrößen
10 ug
£163,00
RP01946-10UG
20 ug
£223,00
RP01946-20UG
50 ug
£336,00
RP01946-50UG
100 ug
£508,00
RP01946-100UG
500 ug
£1478,00
RP01946-500UG
1000 ug
£2335,00
RP01946-1000UG
Über dieses Produkt
- SKU:
- RP01946
- Zusätzliche Namen:
- Cripto, Tdgf1, Teratocarcinoma-derived growth factor, Cripto growth factor, Epidermal growth factor-like Cripto protein
- Weitere Details:
- Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. TDGF1 is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. It is overexpressed in many types of cancers and acts as a growth factor for tumors. Cripto mutants display defects in mesoderm induction and heart morphogenesis, similar to phenotypes seen in Nodal mutants. Cripto can also activate mitogen-activated protein kinase (MAPK) and Akt pathways independently of Nodal by directly binding to a membrane-associated heparan sulfate proteoglycan, glypican-1.
- Formulierung:
- Recombinant Mouse Cripto/TDGF1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg26-Gln150) of Mouse Cripto/TDGF1(Accession #NP_035692.2) fused w
- Immunogen:
- Arg26-Gln150
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01946