Recombinant Mouse Placenta growth factor/PLGF/PGF Protein
Produktgrößen
10 ug
£163,00
RP01941-10UG
20 ug
£223,00
RP01941-20UG
50 ug
£336,00
RP01941-50UG
100 ug
£508,00
RP01941-100UG
500 ug
£1478,00
RP01941-500UG
1000 ug
£2335,00
RP01941-1000UG
Über dieses Produkt
- SKU:
- RP01941
- Zusätzliche Namen:
- Pgf, Plgf,Placenta growth factor, PlGF
- Weitere Details:
- Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternative splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. Human PlGF-1 shares 56%, 55%, 74% and 95% aa identity with the comparable isoform of mouse, rat, canine, and equine PlGF, respectively. PlGF is mainly found as variably glycosylated, secreted, 55-60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes, and some endothelial cells. Circulating PlGF increases during pregnancy, reaching a peak in mid-gestation; this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia.
- Formulierung:
- Recombinant Mouse Placenta growth factor/PLGF/PGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Pro158) of Mouse Placenta growth factor/PL
- Immunogen:
- Ala24-Pro158
- Molekulargewicht:
- 25-35 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01941