Recombinant Human CCL14/HCC-1/HCC-3 Protein
Produktgrößen
20 ug
£193,00
RP01940-20UG
50 ug
£288,00
RP01940-50UG
100 ug
£431,00
RP01940-100UG
500 ug
£1240,00
RP01940-500UG
1000 ug
£1954,00
RP01940-1000UG
Über dieses Produkt
- SKU:
- RP01940
- Zusätzliche Namen:
- CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
- Weitere Details:
- Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.
- Formulierung:
- Recombinant Recombinant Human CCL14/HCC-1/HCC-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Asn93) of Human CCL14/HCC-1/HCC-3 (Accession
- Immunogen:
- Thr20-Asn93
- Molekulargewicht:
- 14-16 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥95%
- Sequenz:
- TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01940