Recombinant Human Mucin-2 /MUC2 Protein
Produktgrößen
100 ug
£508,00
RP01931LQ-100UG
500 ug
£1503,00
RP01931LQ-500UG
1000 ug
£2360,00
RP01931LQ-1000UG
Über dieses Produkt
- SKU:
- RP01931LQ
- Zusätzliche Namen:
- MUC2, SMUC,Mucin-2, MUC-2, Intestinal mucin-2
- Weitere Details:
- MUC2 Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
- Formulierung:
- Recombinant Human Mucin-2 /MUC2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly858-Thr1259) of Human Mucin-2 /MUC2 (Accession #NP_002448.4) fu
- Immunogen:
- Gly858-Thr1259
- Molekulargewicht:
- 60-75 kDa
- Reinheit:
- ≥90%
- Sequenz:
- TCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSIT
- Versandbedingungen:
- Dry Ice
- Lagerbedingungen:
- -70[o]C Aliquot. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01931LQ