Recombinant Rat IL-18 Protein
Produktgrößen
10 ug
£145,00
RP01929-10UG
20 ug
£193,00
RP01929-20UG
50 ug
£288,00
RP01929-50UG
500 ug
£1478,00
RP01929-500UG
1000 ug
£2335,00
RP01929-1000UG
Über dieses Produkt
- SKU:
- RP01929
- Zusätzliche Namen:
- Il18, Igif,Interleukin-18, IL-18, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma
- Weitere Details:
- IL-18 ,Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells and natural killer (NK) cells. Involved in transduction of inflammation downstream of pyroptosis: its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore.
- Formulierung:
- Recombinant Recombinant Rat IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His37-Ser194) of Rat IL-18 (Accession #NP_062038.1) fused with a
- Immunogen:
- His37-Ser194
- Molekulargewicht:
- 20-25 kDa
- Physischer Zustand:
- Lyophilized
- Reinheit:
- ≥90%
- Sequenz:
- FGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
- Versandbedingungen:
- Blue Ice
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- ABclonal Technology
- Typ:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Datenblatt des Herstellers:RP01929